Technical Support: menoci@medizin.uni-goettingen.de
Department of Medical Informatics
University Medical Center Göttingen
Imprint
AG | PID | Antigen Symbol | Antibody Registry | Name | Clonality | Antigen | Quality | Company | Catalog no. |
---|---|---|---|---|---|---|---|---|---|
![]() | primary-0618 | ATG12 | AB_1903898 | Atg12 (D88H11) antibody | monoclonal | detects endogenous levels of total free and Atg5 bound Atg12 protein. | - | Cell Signaling Technology | 4180 |
![]() | primary-0617 | TAGLN | AB_443021 | Anti-TAGLN/Transgelin antibody | polyclonal | Synthetic peptide within Mouse TAGLN/Transgelin aa 150 to the C-terminus conjugated to keyhole limpet haemocyanin. | - | Abcam | ab14106 |
![]() | primary-0616 | TUBB1 | AB_477556 | Anti-β-Tubulin antibody | monoclonal | sea urchin (Lytechinus pictus) sperm axonemal proteins. | - | Sigma-Aldrich | T0198 |
![]() | primary-0615 | AB_10978021 | HA Tag Monoclonal Antibody | monoclonal | HA peptide YPYDVPDYA derivitized to ovalbumin. | - | Thermo Fisher Scientific | 26183 | |
![]() | primary-0614 | CHD6 | Anti-CHD6 Antibody | monoclonal | raised against amino acids 243-320 mapping near the N-terminus of CHD6 of human origin | - | Santa Cruz Biotechnology | sc-393445 | |
![]() | primary-0613 | H3K27me3 | AB_2561020 | Histone H3K27me3 antibody | polyclonal | raised against a peptide including trimethyl-lysine 27 of histone H3. testing | - | Active Motif | 39155 |
![]() | primary-0612 | CBX5 | AB_2614983 | CBX5-human antibody | monoclonal | This HP1α antibody was raised against a recombinant protein corresponding to amino acids 67-119 of mouse HP1α. | - | Active Motif | 39977 |
![]() | primary-0611 | TP53 | AB_331741 | Phospho-p53 (Ser15) antibody | monoclonal | detects endogenous levels of p53 only when phosphorylated at serine 15. | - | Cell Signaling Technology | 9286 |
![]() | primary-0610 | CHEK2 | AB_2080501 | Phospho-Chk2 (Thr68) antibody | monoclonal | detects endogenous levels of Chk2 only when phosphorylated at Thr68. | - | Cell Signaling Technology | 2197 |
![]() | primary-0609 | H2AX | AB_2118009 | Phospho-Histone H2A.X (Ser139) antibody | monoclonal | detects endogenous levels of H2A.X only when phosphorylated at Ser139. | - | Cell Signaling Technology | 9718 |
![]() | primary-0608 | CHEK1 | AB_331212 | Phospho-Chk1 (Ser345) antibody | monoclonal | detects endogenous levels of Chk1 only when phosphorylated at serine 345. | - | Cell Signaling Technology | 2348 |
![]() | primary-0607 | BRCA1 | AB_491003 | Phospho-BRCA1 (Ser1524) Antibody | polyclonal | detects endogenous levels of BRCA1 only when phosphorylated at Ser1524. | - | Cell Signaling Technology | 9009 |
![]() | primary-0606 | ATR | AB_2290281 | Phospho-ATR (Ser428) Antibody | polyclonal | detects endogenous levels of ATR only when phosphorylated at serine 428. | - | Cell Signaling Technology | 2853 |
![]() | primary-0605 | ATM | AB_10835213 | Phospho-ATM (Ser1981) antibody | monoclonal | recognizes endogenous levels of ATM protein only when phosphorylated at Ser1981 | - | Cell Signaling Technology | 5883 |
![]() | primary-0604 | TFEB | AB_11204751 | TFEB Antibody | polyclonal | Between 426 and 476 | - | Bethyl | A303-673A |
![]() | primary-0603 | CHD6 | AB_890573 | CHD6 Antibody | polyclonal | between 2665 and 2715 | - | Bethyl | A301-221A |
![]() | primary-0602 | HTT | AB_532270 | Anti-Polyglutamines antibody | monoclonal | - | Sigma-Aldrich | P1874 | |
![]() | primary-0597 | NEFH | AB_2566782 | Purified anti-Neurofilament Marker (pan axonal, cocktail) Antibody | monoclonal | Homogenized hypothalami recovered from Fischer 344 rats. | - | BioLegend | 837904 |
![]() | primary-0596 | NEFH | AB_2565349 | Anti-Neurofilament H & M (NF-H/NF-M), Hypophosphorylated Antibody | monoclonal | - | BioLegend | 835601 | |
![]() | primary-0595 | NEFH | AB_2715852 | Purified anti-Neurofilament H (NF-H), Nonphosphorylated Antibody | monoclonal | - | BioLegend | 801702 | |
![]() | primary-0594 | NEFH | AB_2650680 | Anti-Neurofilament H (NF-H) Phosphorylated Antibody | monoclonal | - | BioLegend | 801608 | |
![]() | primary-0593 | NF | AB_2314899 | Neurofilament Protein antibody | monoclonal | Neurofilament isolated from normal adult human brain | - | Agilent (Dako) | M0762 |
![]() | primary-0592 | APP | AB_94882 | Anti-APP A4 Antibody | monoclonal | Purified recombinant Alzheimer precursor A4 (pre A4695) fusion protein. | - | Merck Millipore | MAB348 |
![]() | primary-0591 | P2RY12 | AB_2810254 | P2Y12/P2RY12 Antibody | polyclonal | Against a recombinant protein corresponding to amino acids: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM | - | Novus Biologicals | NBP2-33870 |
![]() | primary-0590 | TMEM119 | AB_2681645 | Anti-TMEM119 antibody | polyclonal | transmembrane protein 119 recombinant protein epitope signature tag (PrEST) | - | Sigma-Aldrich (Atlas Antibodies) | HPA051870 |