Technical Support: menoci@medizin.uni-goettingen.de
Department of Medical Informatics
University Medical Center Göttingen
Imprint
AG | PID | Antigen Symbol | Antibody Registry | Name | Clonality | Antigen | Quality | Company | Catalog no. |
---|---|---|---|---|---|---|---|---|---|
![]() | primary-1885 | HTT | AB_10827977 | Huntingtin (D7F7) XP® Rabbit mAb | monoclonal | - | Cell Signaling Technologies | 5656 | |
![]() | primary-1884 | DARPP32 | AB_731843 | Anti-DARPP32 antibody [EP720Y] | monoclonal | The exact immunogen used to generate this antibody is proprietary information. | - | Abcam | ab40801 |
![]() | primary-1883 | PDE10A | AB_2927552 | Anti-PDE10A antibody [EPR22383] | monoclonal | The exact immunogen used to generate this antibody is proprietary information. | - | Abcam | ab227829 |
![]() | primary-1882 | NeuN | AB_2802653 | NeuN Monoclonal Antibody (1B7) | monoclonal | Recombinant protein taken from the N-terminus of human FOX3 expressed in and purified from E. coli | - | Thermo Fisher Scientific (Invitrogen) | MA5-33103 |
![]() | primary-1881 | Iba1 | AB_10972670 | Anti-Iba1 antibody | polyclonal | The exact immunogen used to generate this antibody is proprietary information. | - | Abcam | ab107159 |
![]() | primary-1880 | VGluT1 | AB_2923539 | Anti-VGluT1 antibody [N28-9] | monoclonal | The exact immunogen used to generate this antibody is proprietary information. | - | Abcam | ab134283 |
![]() | primary-1879 | PSD95 | AB_2886821 | PSD95 antibody | polyclonal | - | GeneTex | GTX133091 | |
![]() | primary-1878 | mCherry | AB_2333093 | mCherry Goat Polyclonal Antibody | polyclonal | - | Origene | AB0040-200 | |
![]() | primary-1875 | PECA1 | AB_2161028 | Human/Mouse/Rat CD31/PECAM-1 Antibody | polyclonal | Mouse myeloma cell line NS0-derived recombinant mouse CD31/PECAM-1 Glu18-Lys590 | - | R&D systems | AF3628 |
![]() | primary-1874 | PODXL | AB_2166010 | Mouse Podocalyxin Antibody | monoclonal | Mouse myeloma cell line NS0-derived recombinant mouse Podocalyxin Ser21-Arg402 | - | R&D systems | MAB1556 |
![]() | primary-1872 | TOM22 | AB_1080329 | Anti-TOMM22 antibody produced in rabbit | polyclonal | MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQK | no score - westernblot | Merck (Sigma-Aldrich) | HPA003037 |
![]() | primary-1871 | TOMM20 | AB_2716623 | Anti-TOMM20 antibody [EPR15581-39] - Mitochondrial Marker | monoclonal | The exact immunogen used to generate this antibody is proprietary information. | - | Abcam | ab186734 |
![]() | primary-1870 | AB_2716838 | Mitofusin-2 (D2D10) Rabbit mAb | monoclonal | synthetic peptide corresponding to residues surrounding Val573 of human mitofusin-2 protein. | - | Cell Signaling Technologies | 9482 | |
![]() | primary-1869 | Bax | AB_11004781 | Bax Monoclonal Antibody | monoclonal | A synthetic peptide, aa 3-16 (Cys-GSGEQPRGGGPTSS) of human bax protein | - | Thermo Fisher | MA5-13994 |
![]() | primary-1868 | MRPP3 | Anti-MRPP3 antibody | monoclonal | The exact immunogen used to generate this antibody is proprietary information. | - | Abcam | ab185942 | |
![]() | primary-1866 | TBA1A | AB_1965960 | alpha Tubulin Monoclonal Antibody (DM1A) | monoclonal | Native chick brain microtubules | - | Thermo Fisher Scientific (Invitrogen) | 62204 |
![]() | primary-1864 | PSD95 | Anti-PSD-95 | monoclonal | fusion protein consisting of amino acids 77-299 (PDZ domains 1 and 2) of human PSD-95 | - | Absolute antibody | Ab02108-8.4 | |
![]() | primary-1863 | SYT1 | AB_2832236 | Synaptotagmin1 antibody cytoplasmic tail | monoclonal | Recombinant protein corresponding to AA 80 to 421 from rat Synaptotagmin1 (UniProt Id: P21707) | - | Synaptic Systems | 105 008 |
![]() | primary-1862 | CD11b | AB_393577 | Purified Rat Anti-CD11b | unknown | Mouse Splenic Cells | - | BD Biosciences | 550282 |
![]() | primary-1861 | NeuN | AB_2862578 | NeuN Rabbit mAb | monoclonal | - | ABclonal | A19086 | |
![]() | primary-1860 | SPP1 | AB_2194992 | Mouse Osteopontin/OPN Antibody | unknown | Mouse myeloma cell line NS0-derived recombinant mouse Osteopontin/OPN | - | R&D Systems | AF808 |
![]() | primary-1859 | MRPS25 | AB_2918659 | MRPS25 Monoclonal antibody | monoclonal | MRPS25 fusion protein Ag7846 | - | Proteintech | 67903-1-Ig |
![]() | primary-1858 | MRPS7 | AB_2880650 | MRPS7 Polyclonal antibody | polyclonal | MRPS7 fusion protein Ag25325 | - | Proteintech | 26828-1-AP |
![]() | primary-1857 | MRPL37 | AB_2146040 | MRPL37 Polyclonal antibody | polyclonal | - | Proteintech | 15190-1-AP | |
![]() | primary-1856 | MRPL1 | AB_2145582 | MRPL1 Polyklonaler Antikörper | polyclonal | MRPL1 fusion protein Ag9270 | - | Proteintech | 16254-1-AP |