Technical Support: menoci@medizin.uni-goettingen.de
Department of Medical Informatics
University Medical Center Göttingen
Imprint
AG | PID | Antigen Symbol | Antibody Registry | Name | Clonality | Antigen | Quality | Company | Catalog no. |
---|---|---|---|---|---|---|---|---|---|
![]() | primary-1842 | Biotin-conjugated anti-rabbit IgG | unknown | - | Jackson ImmunoResearch | 111-065-114 | |||
![]() | primary-1840 | A4 | AB_2056583 | Anti-APP A4 Antibody, a.a. 66-81 of APP {NT}, clone 22C11 | monoclonal | - | Merck (Sigma-Aldrich) | MAB348 | |
![]() | primary-1838 | METT10D | AB_2622541 | METT10D (METTL16) Mouse Monoclonal Antibody [Clone ID: OTI3B5] | monoclonal | Full length human recombinant protein of human METT10D(NP_076991) produced in HEK293T cell. | - | Origene | TA504710 |
![]() | primary-1837 | LARP7 | AB_2132693 | LARP7 Polyklonaler Antikörper | polyclonal | LARP7 fusion protein Ag10891 | - | Proteintech | 17067-1-AP |
![]() | primary-1836 | MEPCE | AB_2250635 | MEPCE Polyklonaler Antikörper | polyclonal | MEPCE fusion protein Ag6733 | - | Proteintech | 14917-1-AP |
![]() | primary-1835 | TRMT112 | TRMT112 Antikörper (F-7) | monoclonal | amino acids 20-118 mapping within an internal region of TRMT112 of human origin. | - | Santa Cruz Biotechnology | sc-398481 | |
![]() | primary-1834 | TRMT11 | AB_2209511 | TRMT11 Polyclonal antibody | polyclonal | TRMT11 fusion protein Ag11717 | - | Proteintech | 17555-1-AP |
![]() | primary-1833 | TRMT5 | AB_1080388 | Anti-TRMT5 antibody produced in rabbit | polyclonal | s. description | - | HPA000943 | |
![]() | primary-1832 | THUMPD3 | AB_2674985 | Anti-THUMPD3 antibody produced in rabbit | polyclonal | AGKLPWSNPLKVWKINASFKKKKAKRKKINQNSSKEKINNGQEVKIDQRNVKKEFTSHALDSHILDYYENPAIKEDVSTLIGDDLASCKDETDESSKEE | - | Merck (Sigma-Aldrich) | HPA036171 |
![]() | primary-1831 | THUMPD2 | AB_10964424 | Anti-THUMPD2 antibody produced in rabbit | polyclonal | MCGLGTILLEAAKEWPDVYYVGADVSDSQLLGTWDNLKAAGLEDKIELLKISVIELPLPSESVDIIISDIPFGKKFKLGKDIKSILQEMERVLHVGGTIVLLLS | - | Merck (Sigma-Aldrich) | HPA043042 |
![]() | primary-1830 | TGS1 | AB_1854330 | Anti-TGS1 antibody produced in rabbit | polyclonal | PELAKYWAQRYRLFSRFDDGIKLDREGWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTIQFALTGMRVIAIDIDPVKIALARNNAE | - | Merck (Sigma-Aldrich) | HPA025024 |
![]() | primary-1829 | METTL5 | AB_2142051 | METTL5 Polyclonal antibody | polyclonal | METTL5 fusion protein Ag10232 | - | Proteintech | 16791-1-AP |
![]() | primary-1828 | HA | AB_627809 | HA-Tag Antikörper (F-7) | monoclonal | internal region of the influenza hemagglutinin (HA) protein | - | Santa Cruz Biotechnology | sc-7392 |
![]() | primary-1815 | HA | AB_2533988 | HA Tag Polyclonal Antibody (SG77) | polyclonal | A synthetic peptide corresponding to the nine amino acid sequence HA-tag (YPYDVPDYA). | - | Thermo Fisher Scientific (Invitrogen) | 71-5500 |
![]() | primary-1814 | AB_303248 | Anti-PSD95 antibody [6G6-1C9] - Synaptic Marker | monoclonal | The exact immunogen used to generate this antibody is proprietary information. | - | Abcam | ab2723 | |
![]() | primary-1813 | DLG4 | AB_2292909 | Anti-PSD-95 Antibody (K28/43) | monoclonal | Fusion protein amino acids 77-299 (PDZ domains 1 and 2) of human PSD-95 (accession number P78352) | - | NeuroMab | 75-028 |
![]() | primary-1812 | GEPH | AB_887719 | Gephyrin antibody | monoclonal | ecombinant protein corresponding to AA 307 to 735 from rat Gephyrin (UniProt Id: Q03555) | - | Synaptic Systems | 147 111 |
![]() | primary-1811 | MYC | AB_439694 | Anti-c-Myc antibody, Mouse monoclonal | monoclonal | synthetic peptide of the human p62c-Myc protein | - | Merck (Sigma-Aldrich) | M4439 |
![]() | primary-1810 | ACTA1 | AB_476730 | Monoclonal Anti-Actin antibody produced in mouse | monoclonal | synthetic actin C-terminal peptide, attached to a Multiple Antigen Peptide (MAP) backbone | - | Merck (Sigma-Aldrich) | A4700 |
![]() | primary-1809 | TACC3 | AB_3492052 | Anti-TACC3 antibody [EPR7756] | monoclonal | The exact immunogen used to generate this antibody is proprietary information. | - | Abcam | ab134154 |
![]() | primary-1808 | SMC3 | AB_307122 | Anti-SMC3 antibody | polyclonal | Synthetic Peptide within Human SMC3 conjugated to Keyhole Limpet Haemocyanin. | - | Abcam | ab9263 |
![]() | primary-1807 | Rabbit anti-DNA Polß | unknown | - | Biotol | ABB-A1681 | |||
![]() | primary-1806 | CBX5 | AB_2290973 | Anti-HP1α Antibody, clone15.19s2 | monoclonal | GST fusion protein corresponding to residues 2-191 of human HP1α protein. | - | Merck (Sigma-Aldrich) | 05-689 |
![]() | primary-1805 | FANCI | AB_2676951 | Anti-FANCI antibody produced in rabbit | polyclonal | - | HPA040379 | Merck (Sigma-Aldrich) | |
![]() | primary-1804 | MLH1 | AB_394041 | Purified Mouse Anti-MLH-1 with Control | monoclonal | - | BD Biosciences | 551092 |