Technical Support: support.menoci@medizin.uni-goettingen.de
Department of Medical Informatics
University Medical Center Göttingen
Imprint
| AG | PID | Antigen Symbol | Antibody Registry | Name | Clonality | Antigen | Quality | Company | Catalog no. |
|---|---|---|---|---|---|---|---|---|---|
![]() | primary-1851 | PSMA3 | AB_10538395 | Proteasome 20S α7 subunit monoclonal antibody (MCP72) | monoclonal | - | Enzo Life Sciences | BML-PW8110 | |
![]() | primary-1850 | HSP90 | AB_2881429 | HSP90 Monoklonaler Antikörper | monoclonal | HSP90 fusion protein Ag3826 | - | Proteintech | 60318-1-Ig |
![]() | primary-1849 | ADRM1 | AB_2797798 | ADRM1 (D9Z1U) Rabbit mAb | monoclonal | synthetic peptide corresponding to residues near the amino terminus of human ADRM1 protein. | - | Cell Signaling Technology | 12019 |
![]() | primary-1847 | UBE3C | AB_2621371 | UBE3C Polyclonal Antibody | polyclonal | Region between residue 350 to 400 of Human Ubiquitin Protein Ligase E3C | - | Thermo Fisher Scientific (Bethyl Laboratories) | A304-122A |
![]() | primary-1846 | UBE3C | AB_2548824 | UBE3C Polyclonal Antibody | polyclonal | Recombinant fragment corresponding to a region within amino acids 114 and 387 of Human UBE3C | - | Thermo Fisher Scientific (Invitrogen) | PA5-31350 |
![]() | primary-1845 | PCNA | AB_628110 | PCNA Antikörper (PC10) | monoclonal | rat PCNA made in the protein A expression vector pR1T2T | - | Santa Cruz Biotechnology | sc-56 |
![]() | primary-1844 | NFE2L1 | Anti-NFE2L1 antibody | polyclonal | Recombinant Fragment Protein within Human NF2L1_HUMAN aa 250-550. | - | Abcam | ab238154 | |
![]() | primary-1842 | Biotin-conjugated anti-rabbit IgG | unknown | - | Jackson ImmunoResearch | 111-065-114 | |||
![]() | primary-1840 | A4 | AB_2056583 | Anti-APP A4 Antibody, a.a. 66-81 of APP {NT}, clone 22C11 | monoclonal | - | Merck (Sigma-Aldrich) | MAB348 | |
![]() | primary-1838 | METT10D | AB_2622541 | METT10D (METTL16) Mouse Monoclonal Antibody [Clone ID: OTI3B5] | monoclonal | Full length human recombinant protein of human METT10D(NP_076991) produced in HEK293T cell. | - | Origene | TA504710 |
![]() | primary-1837 | LARP7 | AB_2132693 | LARP7 Polyklonaler Antikörper | polyclonal | LARP7 fusion protein Ag10891 | - | Proteintech | 17067-1-AP |
![]() | primary-1836 | MEPCE | AB_2250635 | MEPCE Polyklonaler Antikörper | polyclonal | MEPCE fusion protein Ag6733 | - | Proteintech | 14917-1-AP |
![]() | primary-1835 | TRMT112 | TRMT112 Antikörper (F-7) | monoclonal | amino acids 20-118 mapping within an internal region of TRMT112 of human origin. | - | Santa Cruz Biotechnology | sc-398481 | |
![]() | primary-1834 | TRMT11 | AB_2209511 | TRMT11 Polyclonal antibody | polyclonal | TRMT11 fusion protein Ag11717 | - | Proteintech | 17555-1-AP |
![]() | primary-1833 | TRMT5 | AB_1080388 | Anti-TRMT5 antibody produced in rabbit | polyclonal | s. description | - | HPA000943 | |
![]() | primary-1832 | THUMPD3 | AB_2674985 | Anti-THUMPD3 antibody produced in rabbit | polyclonal | AGKLPWSNPLKVWKINASFKKKKAKRKKINQNSSKEKINNGQEVKIDQRNVKKEFTSHALDSHILDYYENPAIKEDVSTLIGDDLASCKDETDESSKEE | - | Merck (Sigma-Aldrich) | HPA036171 |
![]() | primary-1831 | THUMPD2 | AB_10964424 | Anti-THUMPD2 antibody produced in rabbit | polyclonal | MCGLGTILLEAAKEWPDVYYVGADVSDSQLLGTWDNLKAAGLEDKIELLKISVIELPLPSESVDIIISDIPFGKKFKLGKDIKSILQEMERVLHVGGTIVLLLS | - | Merck (Sigma-Aldrich) | HPA043042 |
![]() | primary-1830 | TGS1 | AB_1854330 | Anti-TGS1 antibody produced in rabbit | polyclonal | PELAKYWAQRYRLFSRFDDGIKLDREGWFSVTPEKIAEHIAGRVSQSFKCDVVVDAFCGVGGNTIQFALTGMRVIAIDIDPVKIALARNNAE | - | Merck (Sigma-Aldrich) | HPA025024 |
![]() | primary-1829 | METTL5 | AB_2142051 | METTL5 Polyclonal antibody | polyclonal | METTL5 fusion protein Ag10232 | - | Proteintech | 16791-1-AP |
![]() | primary-1828 | HA | AB_627809 | HA-Tag Antikörper (F-7) | monoclonal | internal region of the influenza hemagglutinin (HA) protein | - | Santa Cruz Biotechnology | sc-7392 |
![]() | primary-1815 | HA | AB_2533988 | HA Tag Polyclonal Antibody (SG77) | polyclonal | A synthetic peptide corresponding to the nine amino acid sequence HA-tag (YPYDVPDYA). | - | Thermo Fisher Scientific (Invitrogen) | 71-5500 |
![]() | primary-1814 | AB_303248 | Anti-PSD95 antibody [6G6-1C9] - Synaptic Marker | monoclonal | The exact immunogen used to generate this antibody is proprietary information. | - | Abcam | ab2723 | |
![]() | primary-1813 | DLG4 | AB_2292909 | Anti-PSD-95 Antibody (K28/43) | monoclonal | Fusion protein amino acids 77-299 (PDZ domains 1 and 2) of human PSD-95 (accession number P78352) | - | NeuroMab | 75-028 |
![]() | primary-1812 | GEPH | AB_887719 | Gephyrin antibody | monoclonal | ecombinant protein corresponding to AA 307 to 735 from rat Gephyrin (UniProt Id: Q03555) | - | Synaptic Systems | 147 111 |
![]() | primary-1811 | MYC | AB_439694 | Anti-c-Myc antibody, Mouse monoclonal | monoclonal | synthetic peptide of the human p62c-Myc protein | - | Merck (Sigma-Aldrich) | M4439 |