Technical Support: menoci@medizin.uni-goettingen.de
Department of Medical Informatics
University Medical Center Göttingen
Imprint
Antibody Catalogue
The catalogue currently contains 1873 antibodies (primary: 1596, secondary: 277).
Search
New primary antibodies
| AG | PID | Antigen Symbol | Antibody Registry | Name | Clonality | Antigen | Quality | Company | Catalog no. |
|---|---|---|---|---|---|---|---|---|---|
 | primary-1872 | TOM22 | AB_1080329 | Anti-TOMM22 antibody produced in rabbit | polyclonal | MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQK | no score - westernblot | Merck (Sigma-Aldrich) | HPA003037 |
| primary-1871 | TOMM20 | AB_2716623 | Anti-TOMM20 antibody [EPR15581-39] - Mitochondrial Marker | monoclonal | The exact immunogen used to generate this antibody is proprietary information. | - | Abcam | ab186734 |
| primary-1870 | AB_2716838 | Mitofusin-2 (D2D10) Rabbit mAb | monoclonal | synthetic peptide corresponding to residues surrounding Val573 of human mitofusin-2 protein. | - | Cell Signaling Technologies | 9482 | |
| primary-1869 | Bax | AB_11004781 | Bax Monoclonal Antibody | monoclonal | A synthetic peptide, aa 3-16 (Cys-GSGEQPRGGGPTSS) of human bax protein | - | Thermo Fisher | MA5-13994 |
| primary-1868 | MRPP3 | Anti-MRPP3 antibody | monoclonal | The exact immunogen used to generate this antibody is proprietary information. | - | Abcam | ab185942 |
New secondary antibodies
| AG | PID | Antibody Registry | Name | Excitation | Quality | Company | Catalog no. |
|---|---|---|---|---|---|---|---|
| secondary-1873 | AB_2539799 | Invitrogen Oregon Green 488 Goat Anti-Mouse IgG (H+L) | - | Thermo Fisher Scientific (Invitrogen) | O6380 | |
| secondary-1867 | AB_2714032 | Goat Anti-Rabbit IgG H&L (Alexa Fluor® 647) preadsorbed | 650 | - | Abcam | ab150083 |
| secondary-1865 | AB_10561522 | Goat anti-Rat IgG (H+L) Cross-Adsorbed Secondary Antibody, Alexa Fluor™ 594 | 590 | - | Thermo Fisher Scientific (Invitrogen) | A-11007 |
| secondary-1848 | AB_2651127 | IRDye® 800CW Goat anti-Rabbit IgG Secondary Antibody | - | LICORbio | 925-32211 | |
| secondary-1843 | Biotin-conjugated anti-rabbit IgG | - | Jackson ImmunoResearch | 111-065-114 |
