Technical Support: menoci@medizin.uni-goettingen.de
Department of Medical Informatics
University Medical Center Göttingen
Imprint
AG | PID | Antigen Symbol | Antibody Registry | Name | Clonality | Antigen | Quality | Company | Catalog no. |
---|---|---|---|---|---|---|---|---|---|
primary-1216 | TOMM20 | AB_2303717 | TOMM20 Antibody (4F3) | monoclonal | TOMM20 (AAH66335, 1 a.a. ~ 145 a.a) full-length recombinant protein with GST tag. | - | Novus Biologicals | H00009804-M01 | |
primary-1215 | CD107a | AB_657531 | CD107a (LAMP-1) Monoclonal Antibody (eBio1D4B (1D4B)) | monoclonal | - | Thermo Fisher Scientific (Invitrogen) | 14-1071-82 | ||
primary-1214 | RAB11A | AB_2533987 | RAB11A Polyclonal Antibody | polyclonal | Synthetic peptide derived from the C-terminal hypervariable region of the human Rab11a sequence. | - | Thermo Fisher Scientific (Invitrogen) | 71-5300 | |
primary-1213 | BAP31 | AB_2065142 | BAP31 Polyclonal antibody | polyclonal | BAP31 fusion protein Ag1668 | - | Proteintech | 11200-1-AP | |
primary-1212 | KDEL | AB_10618036 | KDEL monoclonal antibody (10C3) | monoclonal | Synthetic peptide corresponding to aa 649-654 (S649EKDEL654) of rat Grp78. | - | Enzo Life Sciences | ADI-SPA-827 | |
primary-1211 | PABPC1L | PABPC1L Antikörper (H-1) | monoclonal | raised against amino acids 485-529 mapping within an internal region of PABPC1L of mouse origin | - | Santa Cruz Biotechnology | sc-515476 | ||
primary-1210 | eIF4ENIF1 | AB_2640973 | eIF4ENIF1 Polyclonal Antibody | polyclonal | - | Thermo Fisher Scientific (Invitrogen) | |||
primary-1209 | LSM14B | AB_2664653 | LSM14B Polyclonal Antibody | polyclonal | Recombinant Human LSM14B | - | Thermo Fisher Scientific (Invitrogen) | PA5-66371 | |
primary-1208 | DDX6 | Anti-DDX6 antibody, Mouse monoclonal | monoclonal | - | Sigma-Aldrich | SAB4200837 | |||
primary-1207 | DDX6 | Recombinant Anti-DDX6 antibody [EPR12146] | monoclonal | Synthetic peptide within Human DDX6 aa 100-200 (Cysteine residue). The exact sequence is proprietary. | - | Abcam | ab174277 | ||
primary-1206 | MSY2 | AB_776541 | Anti-MSY2/YBOX2/YBX2 antibody | polyclonal | Synthetic peptide corresponding to Mouse MSY2/YBOX2/YBX2 aa 300 to the C-terminus (C terminal). | - | Abcam | ab33164 | |
primary-1205 | CYCS | AB_627381 | cytochrome c Antikörper (6H2) | monoclonal | - | Santa Cruz Biotechnology | sc-13561 | ||
primary-1204 | ZAR1 | AB_2218783 | ZAR1(C-14) | polyclonal | - | Santa Cruz Biotechnology | sc-55994 | ||
primary-1203 | FluoTag®-X2 anti-Mouse Ig kappa light chain | unknown | - | NanoTag Biotechnologies | N1202-Ab635P-S | ||||
primary-1202 | FluoTag®-X2 anti-Rabbit IgG | unknown | - | NanoTag Biotechnologies | N2402-Ab635P-S | ||||
primary-1201 | FluoTag®-X2 anti-PSD95 | unknown | - | NanoTag Biotechnologies | N3702-Ab580-L | ||||
primary-1200 | MYC | AB_2266850 | c-Myc antibody (9E 10) | monoclonal | c-Myc (human; C-terminus a.a. 408-439) synthetic peptide. AEEQKLISEEDLLRKRREQLKHKLEQLRNSCA; a.a. 408-432 | - | DSHB | ||
primary-1199 | VCP | AB_527461 | p97/VCP Antibody | polyclonal | region between residue 750 and the C-terminus (residue 806) of human Valosin-Containing Protein | - | |||
primary-1198 | PARP1 | AB_10699459 | poly(ADP-ribose) polymerase 1 | monoclonal | large fragment (89 kDa) of human PARP1 protein produced by caspase cleavage. | - | Cell Signaling Technology | 5625 | |
primary-1197 | GALNS | AB_11152499 | GALNS Polyclonal Antibody | polyclonal | - | Thermo Fisher Scientific (Invitrogen) | PA5-22098 | ||
primary-1196 | ARSA | AB_1078220 | Anti-ARSA antibody produced in rabbit | polyclonal | LLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGSAHSDTTADPACHASSSLTAHEPPLLYDLSKDPGENYNLLGGVAGATPEVLQALKQLQLLKAQLDAAVTFGPSQ | - | Sigma-Aldrich (Atlas Antibodies) | HPA005554 | |
primary-1192 | CALB2 | AB_2721226 | Calretinin antibody | polyclonal | - | Swant | 7697 | ||
primary-1191 | BSN | AB_2661779 | Bassoon antibody | unknown | Recombinant protein corresponding to residues corresponding to central region rat Bassoon. (UniProt Id: O88778) | - | Synaptic Systems | 141 016 | |
primary-1189 | PCLO | AB_2619830 | Piccolo antibody | unknown | Recombinant protein corresponding to a central region of rat piccolo (UniProt Id: Q9JKS6) | - | Synaptic Systems | 142 113 | |
primary-1188 | HOME1 | AB_2120990 | Homer1 antibody | unknown | Recombinant protein corresponding to the N-terminal half of human Homer 1 (UniProt Id: Q86YM7) | - | Synaptic Systems | 160 002 |