Primary antibodies

Export

PID	Antigen Symbol	Antibody Registry	Name	Clonality	Antigen	Quality	Company	Catalog no.
primary-1200	MYC	AB_2266850	c-Myc antibody (9E 10)	monoclonal	c-Myc (human; C-terminus a.a. 408-439) synthetic peptide. AEEQKLISEEDLLRKRREQLKHKLEQLRNSCA; a.a. 408-432	-	DSHB
primary-1199	VCP	AB_527461	p97/VCP Antibody	polyclonal	region between residue 750 and the C-terminus (residue 806) of human Valosin-Containing Protein	-
primary-1198	PARP1	AB_10699459	poly(ADP-ribose) polymerase 1	monoclonal	large fragment (89 kDa) of human PARP1 protein produced by caspase cleavage.	-	Cell Signaling Technology	5625
primary-1197	GALNS	AB_11152499	GALNS Polyclonal Antibody	polyclonal		-	Thermo Fisher Scientific (Invitrogen)	PA5-22098
primary-1196	ARSA	AB_1078220	Anti-ARSA antibody produced in rabbit	polyclonal	LLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGSAHSDTTADPACHASSSLTAHEPPLLYDLSKDPGENYNLLGGVAGATPEVLQALKQLQLLKAQLDAAVTFGPSQ	-	Sigma-Aldrich (Atlas Antibodies)	HPA005554
primary-1192	CALB2	AB_2721226	Calretinin antibody	polyclonal		-	Swant	7697
primary-1191	BSN	AB_2661779	Bassoon antibody	unknown	Recombinant protein corresponding to residues corresponding to central region rat Bassoon. (UniProt Id: O88778)	-	Synaptic Systems	141 016
primary-1189	PCLO	AB_2619830	Piccolo antibody	unknown	Recombinant protein corresponding to a central region of rat piccolo (UniProt Id: Q9JKS6)	-	Synaptic Systems	142 113
primary-1188	HOME1	AB_2120990	Homer1 antibody	unknown	Recombinant protein corresponding to the N-terminal half of human Homer 1 (UniProt Id: Q86YM7)	-	Synaptic Systems	160 002
primary-1187	CACNA1D	AB_2039775	Anti-CaV1.3 (CACNA1D) Antibody - Voltage-dependent L-type calcium channel subunit α1D	polyclonal	Peptide (C)DNKVTIDDYQEEAEDKD, corresponding to amino acid residues 859-875 of rat CaV1.3	-		ACC-005
primary-1186	VCL	AB_10603627	Vinculin	monoclonal	total protein	-	Sigma-Aldrich	V9264
primary-1183	TNNI3	AB_11000742	Cardiac Troponin T Monoclonal Antibody (13-11)	monoclonal		-	Thermo Fisher Scientific	MA5-12960
primary-1182	MYBPC3	AB_10865856	Recombinant Anti-MYBPC3 antibody [EPR3008(2)]	monoclonal	Synthetic peptide. This information is proprietary to Abcam and/or its suppliers.	-	Abcam	ab108522
primary-1181	WASL	AB_10638478	WASL Polyclonal antibody	polyclonal	WASL fusion protein Ag5424	-	Proteintech	14306-1-AP
primary-1180	CCDC53	AB_2879551	CCDC53 Polyclonal antibody	polyclonal		-	Proteintech	24445-1-AP
primary-1179	MYH7	AB_2736821	MYH7-specific Polyclonal antibody	polyclonal	Peptide	-	Proteintech	22280-1-AP
primary-1176	MLC-2A	AB_2266770	MLC-2A antibody	monoclonal	Full-length recombinant human MLC-2A (UniProt Id: Q01449)	-	Synaptic Systems	311 011AT1
primary-1175	TFRC	AB_2201506	Transferrin antibody	monoclonal	purified Golgi membranes isolated from Caco-2 cells	-	DSHB	G1/221/12
primary-1174	EEA1	AB_2096814	EEA1 Antibody	polyclonal	synthetic peptide corresponding to residues surrounding Gly14 of human EEA1 protein.	-	Cell Signaling Technology	2411
primary-1173	DRP1	AB_2093525	DRP1 (C-terminal) Polyclonal antibody	polyclonal	DRP1 (C-terminal) fusion protein Ag3644	-	Proteintech	12957-1-AP
primary-1172	AP1B1	AB_2058204	AP1B1 Polyclonal antibody	polyclonal	AP1B1 fusion protein Ag10417	-	Proteintech	16932-1-AP
primary-1171		AB_2056524	Apolipoprotein AI Polyclonal antibody	polyclonal		-	Proteintech	14427-1-AP
primary-1170	RHOA	AB_1961799	Active RhoA	monoclonal	full length protein of active RhoA	-	NewEast Biosciences	26904
primary-1169		AB_1512171	TRA-1-81 Antibody (Purified), Mouse anti-Human	monoclonal	Human embryonal carcinoma cell line 2102Ep	-	Stemgent	09-0011
primary-1168	SOX2	AB_792071	SOX2 Antibody - BSA Free	polyclonal	A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431]	-	Novus Biologicals	NB110-37235SS