Technical Support: menoci@medizin.uni-goettingen.de
Department of Medical Informatics
University Medical Center Göttingen
Imprint
AG | PID | Antigen Symbol | Antibody Registry | Name | Clonality | Antigen | Quality | Company | Catalog no. |
---|---|---|---|---|---|---|---|---|---|
![]() | primary-0604 | TFEB | AB_11204751 | TFEB Antibody | polyclonal | Between 426 and 476 | - | Bethyl | A303-673A |
![]() | primary-0603 | CHD6 | AB_890573 | CHD6 Antibody | polyclonal | between 2665 and 2715 | - | Bethyl | A301-221A |
![]() | primary-0602 | HTT | AB_532270 | Anti-Polyglutamines antibody | monoclonal | - | Sigma-Aldrich | P1874 | |
![]() | primary-0597 | NEFH | AB_2566782 | Purified anti-Neurofilament Marker (pan axonal, cocktail) Antibody | monoclonal | Homogenized hypothalami recovered from Fischer 344 rats. | - | BioLegend | 837904 |
![]() | primary-0596 | NEFH | AB_2565349 | Anti-Neurofilament H & M (NF-H/NF-M), Hypophosphorylated Antibody | monoclonal | - | BioLegend | 835601 | |
![]() | primary-0595 | NEFH | AB_2715852 | Purified anti-Neurofilament H (NF-H), Nonphosphorylated Antibody | monoclonal | - | BioLegend | 801702 | |
![]() | primary-0594 | NEFH | AB_2650680 | Anti-Neurofilament H (NF-H) Phosphorylated Antibody | monoclonal | - | BioLegend | 801608 | |
![]() | primary-0593 | NF | AB_2314899 | Neurofilament Protein antibody | monoclonal | Neurofilament isolated from normal adult human brain | - | Agilent (Dako) | M0762 |
![]() | primary-0592 | APP | AB_94882 | Anti-APP A4 Antibody | monoclonal | Purified recombinant Alzheimer precursor A4 (pre A4695) fusion protein. | - | Merck Millipore | MAB348 |
![]() | primary-0591 | P2RY12 | AB_2810254 | P2Y12/P2RY12 Antibody | polyclonal | Against a recombinant protein corresponding to amino acids: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM | - | Novus Biologicals | NBP2-33870 |
![]() | primary-0590 | TMEM119 | AB_2681645 | Anti-TMEM119 antibody | polyclonal | transmembrane protein 119 recombinant protein epitope signature tag (PrEST) | - | Sigma-Aldrich (Atlas Antibodies) | HPA051870 |
![]() | primary-0589 | BCAS1 | AB_10839529 | Anti-NaBC1 Antibody | monoclonal | raised against amino acids 365-571 of NaBC1 of human origin | - | Santa Cruz Biotechnology | sc-136342 |
![]() | primary-0588 | CNP | AB_2728547 | Purified anti-Myelin CNPase Antibody | monoclonal | - | BioLegend | 836403 | |
![]() | primary-0587 | MBP | AB_305869 | Anti-Myelin Basic Protein antibody | monoclonal | Full length protein corresponding to Cow Myelin Basic Protein. | - | Abcam | ab7349 |
![]() | primary-0586 | PLP1 | AB_2237198 | Myelin Proteolipid Protein antibody | monoclonal | Synthetic peptide GRGTKF corresponding to C terminal region of myelin proteolipid protein | - | Bio Rad | MCA839G |
![]() | primary-0584 | METTL4 | METTL4 antibody | unknown | - | Santa Cruz Biotechnology | sc-247960 | ||
![]() | primary-0581 | TH | AB_11156128 | Anti-Tyrosine Hydroxylase antibody [TH-100] | monoclonal | Rat Tyrosine Hydroxylase. | - | Abcam | ab129991 |
![]() | primary-0580 | L1CAM | Anti-NCAM-L1 Antibody | monoclonal | epitope mapping between amino acids 1231-1258 within a C-terminal cytoplasmic domain of NCAM-L1,human origin | - | Santa Cruz Biotechnology | sc-514360 | |
![]() | primary-0579 | CANX | AB_476845 | Anti-Calnexin antibody | polyclonal | Synthetic peptide corresponding to the c-terminus of human calnexin (amino acids 573-592) conjugated to KLH. | - | Sigma-Aldrich | C4731 |
![]() | primary-0578 | CD63 | AB_627877 | Anti-CD63 Antibody | monoclonal | raised against full length CD63 of human origin | - | Santa Cruz Biotechnology | sc-5275 |
![]() | primary-0577 | FLOT2 | AB_397767 | Purified Mouse Anti-Flotillin-2 | monoclonal | Human ESA aa. 122-379 | - | BD Biosciences | 610384 |
![]() | primary-0576 | POLR2C | AB_11218388 | RPB3 Antibody | polyclonal | Between 225 and 275 | - | Bethyl | A303-771A |
![]() | primary-0575 | RPAP2 | AB_2646710 | RPAP2 Polyclonal Antibody | polyclonal | Recombinant protein corresponding to Human RPAP2 | - | Thermo Fisher Scientific | PA5-61244 |
![]() | primary-0569 | SUN1 | AB_1080462 | ANTI-SUN1 antibody | polyclonal | Sad1/unc-84 protein-like 1 recombinant protein epitope signature tag (PrEST) | - | Sigma-Aldrich | HPA008346 |
![]() | primary-0568 | TUBG1 | AB_477575 | Anti-γ-Tubulin antibody | polyclonal | synthetic peptide corresponding to N-terminal region of human γ-tubulin (amino acids 38-53& C-terminally added lysine) | - | Sigma-Aldrich | T3559 |