Primary antibodies

Export

PID	Antigen Symbol	Antibody Registry	Name	Clonality	Antigen	Quality	Company	Catalog no.
primary-0893	ATP5A	AB_301447	Anti-ATP5A antibody [15H4C4] - Mitochondrial Marker	monoclonal	Tissue, cells or virus. This information is considered to be commercially sensitive.	-	Abcam	ab14748
primary-0892	GFER	AB_10608344	ALR Antibody (FL-205)	polyclonal		-	Santa Cruz Biotechnology	sc-134869
primary-0891	MRPL3	AB_10639509	MRPL3 Polyclonal antibody	polyclonal	MRPL3 fusion protein Ag9970	-	Proteintech	16584-1-AP
primary-0890	SARS2		Anti-SARS2 antibody	polyclonal	Recombinant fragment within Human SARS2 (internal sequence).	-	Abcam	ab229227
primary-0889	TRIT1	AB_1858345	Anti-TRIT1 antibody	polyclonal	Synthetic peptide directed towards the C terminal region of human TRIT1	-	Sigma-Aldrich	AV39298
primary-0888	OSGEPL1	AB_2813600	OSGEPL1 Polyclonal Antibody	polyclonal	Recombinant Human Probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial protein (1-270AA)	-	Thermo Fisher Scientific (Invitrogen)	PA5-98987
primary-0885	METTL8	AB_10670116	Anti-METTL8 antibody	polyclonal	methyltransferase like 8 recombinant protein epitope signature tag (PrEST)	-	Sigma-Aldrich (Atlas Antibodies)	HPA035421
primary-0884	RBFOX3	AB_10711040	Anti-NeuN antibody [1B7] - Neuronal Marker	monoclonal	Recombinant fragment corresponding to Human NeuN aa 1-100 (N terminal). Expressed in and purified from E. coli.	-	Abcam	ab104224
primary-0883	SQSTM1	AB_2885112	Recombinant Anti-SQSTM1 / p62 antibody [EPR18351]	monoclonal	Recombinant full length protein. This information is proprietary to Abcam and/or its suppliers.	-	Abcam	ab207305
primary-0881	MYL7	AB_887737	MLC-2A antibody	monoclonal	Recombinant protein corresponding to AA 1 to 175 from human MLC-2A	-	Synaptic Systems	311 011
primary-0880	NPPA	AB_2683660	Anti-NPPA Antibody	polyclonal	Antigen Sequence GQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWT	-	Atlas Antibodies	HPA058269
primary-0879	STOML2	AB_2286822	STOML2 Polyclonal antibody	polyclonal	STOML2 fusion protein Ag0363	-	Proteintech	10348-1-AP
primary-0878	PHB	AB_2164476	Prohibitin Polyclonal antibody	polyclonal	Prohibitin fusion protein Ag1240	-	Proteintech	10787-1-AP
primary-0877	AP3S1		AP3S1 Rabbit Polyclonal Antibody	polyclonal	raised against a 19 amino acid synthetic peptide near the center of human AP3S1.	-	Origene	TA319631
primary-0876	HPRT1	AB_297217	Anti-HPRT antibody	polyclonal	Synthetic peptide	-	Abcam	ab10479
primary-0875	BECN1	AB_1903911	Beclin-1 (D40C5) Rabbit mAb	monoclonal	Beclin-1 (D40C5) Rabbit mAb detects endogenous levels of total Beclin-1 protein.	-	Cell Signaling Technology	3495
primary-0874	TUB	AB_2884950	hFAB™ Rhodamine Anti-Tubulin Primary Antibody	unknown	Recombinant human β-tubulin expressed in E.coli	-	Bio Rad	12004166
primary-0873	MAP1LC3B	AB_2137707	LC3B (D11) XP® Rabbit mAb	monoclonal	LC3B (D11) XP® Rabbit mAb detects endogenous levels of total LC3B protein.	-	Cell Signaling Technology	3868
primary-0872	LAMP1	AB_449893	Anti-LAMP1 antibody	monoclonal	Plasma membrane fraction of mouse embryo NIH3T3 cell line.	-	Abcam	ab25245
primary-0871	AP3M1	AB_2715538	Recombinant Anti-AP3M1 antibody	monoclonal	Synthetic peptide.	-	Abcam	ab201227
primary-0870	CLTC	AB_303256	Anti-Clathrin heavy chain antibody [X22]	monoclonal	Full length native protein (purified) corresponding to Human Clathrin heavy chain.	-	Abcam	ab2731
primary-0868	His-Tag	AB_2744546	His-Tag (D3I1O) XP® Rabbit mAb	monoclonal	Antibody recognizes 6xHis-tag fused to either the amino or carboxy terminus of targeted proteins in transfected cells.	-	Cell Signaling Technology	12698
primary-0866	MBP	AB_2799920	Myelin Basic Protein (D8X4Q) XP® Rabbit mAb	monoclonal	Myelin Basic Protein (D8X4Q) XP® Rabbit mAb recognizes endogenous levels of total myelin basic protein.	-	Cell Signaling Technology	78896
primary-0865	GFAP	AB_887720	GFAP antibody	polyclonal	Recombinant protein corresponding to AA 1 to 432 from human GFAP	-	Synaptic Systems	173 002
primary-0864	RBFOX3	AB_2619988	NeuN antibody	polyclonal	Recombinant protein corresponding to AA 1 to 97 from mouse NeuN	-	Synaptic Systems	266 004