Technical Support: menoci@medizin.uni-goettingen.de
Department of Medical Informatics
University Medical Center Göttingen
Imprint
AG | PID | Antigen Symbol | Antibody Registry | Name | Clonality | Antigen | Quality | Company | Catalog no. |
---|---|---|---|---|---|---|---|---|---|
![]() | primary-1202 | FluoTag®-X2 anti-Rabbit IgG | unknown | - | NanoTag Biotechnologies | N2402-Ab635P-S | |||
![]() | primary-1201 | FluoTag®-X2 anti-PSD95 | unknown | - | NanoTag Biotechnologies | N3702-Ab580-L | |||
![]() | primary-1200 | MYC | AB_2266850 | c-Myc antibody (9E 10) | monoclonal | c-Myc (human; C-terminus a.a. 408-439) synthetic peptide. AEEQKLISEEDLLRKRREQLKHKLEQLRNSCA; a.a. 408-432 | - | DSHB | |
![]() | primary-1199 | VCP | AB_527461 | p97/VCP Antibody | polyclonal | region between residue 750 and the C-terminus (residue 806) of human Valosin-Containing Protein | - | ||
![]() | primary-1198 | PARP1 | AB_10699459 | poly(ADP-ribose) polymerase 1 | monoclonal | large fragment (89 kDa) of human PARP1 protein produced by caspase cleavage. | - | Cell Signaling Technology | 5625 |
![]() | primary-1197 | GALNS | AB_11152499 | GALNS Polyclonal Antibody | polyclonal | - | Thermo Fisher Scientific (Invitrogen) | PA5-22098 | |
![]() | primary-1196 | ARSA | AB_1078220 | Anti-ARSA antibody produced in rabbit | polyclonal | LLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGSAHSDTTADPACHASSSLTAHEPPLLYDLSKDPGENYNLLGGVAGATPEVLQALKQLQLLKAQLDAAVTFGPSQ | - | Sigma-Aldrich (Atlas Antibodies) | HPA005554 |
![]() | primary-1192 | CALB2 | AB_2721226 | Calretinin antibody | polyclonal | - | Swant | 7697 | |
![]() | primary-1191 | BSN | AB_2661779 | Bassoon antibody | unknown | Recombinant protein corresponding to residues corresponding to central region rat Bassoon. (UniProt Id: O88778) | - | Synaptic Systems | 141 016 |
![]() | primary-1189 | PCLO | AB_2619830 | Piccolo antibody | unknown | Recombinant protein corresponding to a central region of rat piccolo (UniProt Id: Q9JKS6) | - | Synaptic Systems | 142 113 |
![]() | primary-1188 | HOME1 | AB_2120990 | Homer1 antibody | unknown | Recombinant protein corresponding to the N-terminal half of human Homer 1 (UniProt Id: Q86YM7) | - | Synaptic Systems | 160 002 |
![]() | primary-1187 | CACNA1D | AB_2039775 | Anti-CaV1.3 (CACNA1D) Antibody - Voltage-dependent L-type calcium channel subunit α1D | polyclonal | Peptide (C)DNKVTIDDYQEEAEDKD, corresponding to amino acid residues 859-875 of rat CaV1.3 | - | ACC-005 | |
![]() | primary-1186 | VCL | AB_10603627 | Vinculin | monoclonal | total protein | - | Sigma-Aldrich | V9264 |
![]() | primary-1183 | TNNI3 | AB_11000742 | Cardiac Troponin T Monoclonal Antibody (13-11) | monoclonal | - | Thermo Fisher Scientific | MA5-12960 | |
![]() | primary-1182 | MYBPC3 | AB_10865856 | Recombinant Anti-MYBPC3 antibody [EPR3008(2)] | monoclonal | Synthetic peptide. This information is proprietary to Abcam and/or its suppliers. | - | Abcam | ab108522 |
![]() | primary-1181 | WASL | AB_10638478 | WASL Polyclonal antibody | polyclonal | WASL fusion protein Ag5424 | - | Proteintech | 14306-1-AP |
![]() | primary-1180 | CCDC53 | AB_2879551 | CCDC53 Polyclonal antibody | polyclonal | - | Proteintech | 24445-1-AP | |
![]() | primary-1179 | MYH7 | AB_2736821 | MYH7-specific Polyclonal antibody | polyclonal | Peptide | - | Proteintech | 22280-1-AP |
![]() | primary-1176 | MLC-2A | AB_2266770 | MLC-2A antibody | monoclonal | Full-length recombinant human MLC-2A (UniProt Id: Q01449) | - | Synaptic Systems | 311 011AT1 |
![]() | primary-1175 | TFRC | AB_2201506 | Transferrin antibody | monoclonal | purified Golgi membranes isolated from Caco-2 cells | - | DSHB | G1/221/12 |
![]() | primary-1174 | EEA1 | AB_2096814 | EEA1 Antibody | polyclonal | synthetic peptide corresponding to residues surrounding Gly14 of human EEA1 protein. | - | Cell Signaling Technology | 2411 |
![]() | primary-1173 | DRP1 | AB_2093525 | DRP1 (C-terminal) Polyclonal antibody | polyclonal | DRP1 (C-terminal) fusion protein Ag3644 | - | Proteintech | 12957-1-AP |
![]() | primary-1172 | AP1B1 | AB_2058204 | AP1B1 Polyclonal antibody | polyclonal | AP1B1 fusion protein Ag10417 | - | Proteintech | 16932-1-AP |
![]() | primary-1171 | AB_2056524 | Apolipoprotein AI Polyclonal antibody | polyclonal | - | Proteintech | 14427-1-AP | ||
![]() | primary-1170 | RHOA | AB_1961799 | Active RhoA | monoclonal | full length protein of active RhoA | - | NewEast Biosciences | 26904 |