Primary antibodies

Export

PID	Antigen Symbol	Antibody Registry	Name	Clonality	Antigen	Quality	Company	Catalog no.
primary-1213	BAP31	AB_2065142	BAP31 Polyclonal antibody	polyclonal	BAP31 fusion protein Ag1668	-	Proteintech	11200-1-AP
primary-1212	KDEL	AB_10618036	KDEL monoclonal antibody (10C3)	monoclonal	Synthetic peptide corresponding to aa 649-654 (S649EKDEL654) of rat Grp78.	-	Enzo Life Sciences	ADI-SPA-827
primary-1211	PABPC1L		PABPC1L Antikörper (H-1)	monoclonal	raised against amino acids 485-529 mapping within an internal region of PABPC1L of mouse origin	-	Santa Cruz Biotechnology	sc-515476
primary-1210	eIF4ENIF1	AB_2640973	eIF4ENIF1 Polyclonal Antibody	polyclonal		-	Thermo Fisher Scientific (Invitrogen)
primary-1209	LSM14B	AB_2664653	LSM14B Polyclonal Antibody	polyclonal	Recombinant Human LSM14B	-	Thermo Fisher Scientific (Invitrogen)	PA5-66371
primary-1208	DDX6		Anti-DDX6 antibody, Mouse monoclonal	monoclonal		-	Sigma-Aldrich	SAB4200837
primary-1207	DDX6		Recombinant Anti-DDX6 antibody [EPR12146]	monoclonal	Synthetic peptide within Human DDX6 aa 100-200 (Cysteine residue). The exact sequence is proprietary.	-	Abcam	ab174277
primary-1206	MSY2	AB_776541	Anti-MSY2/YBOX2/YBX2 antibody	polyclonal	Synthetic peptide corresponding to Mouse MSY2/YBOX2/YBX2 aa 300 to the C-terminus (C terminal).	-	Abcam	ab33164
primary-1205	CYCS	AB_627381	cytochrome c Antikörper (6H2)	monoclonal		-	Santa Cruz Biotechnology	sc-13561
primary-1204	ZAR1	AB_2218783	ZAR1(C-14)	polyclonal		-	Santa Cruz Biotechnology	sc-55994
primary-1203			FluoTag®-X2 anti-Mouse Ig kappa light chain	unknown		-	NanoTag Biotechnologies	N1202-Ab635P-S
primary-1202			FluoTag®-X2 anti-Rabbit IgG	unknown		-	NanoTag Biotechnologies	N2402-Ab635P-S
primary-1201			FluoTag®-X2 anti-PSD95	unknown		-	NanoTag Biotechnologies	N3702-Ab580-L
primary-1200	MYC	AB_2266850	c-Myc antibody (9E 10)	monoclonal	c-Myc (human; C-terminus a.a. 408-439) synthetic peptide. AEEQKLISEEDLLRKRREQLKHKLEQLRNSCA; a.a. 408-432	-	DSHB
primary-1199	VCP	AB_527461	p97/VCP Antibody	polyclonal	region between residue 750 and the C-terminus (residue 806) of human Valosin-Containing Protein	-
primary-1198	PARP1	AB_10699459	poly(ADP-ribose) polymerase 1	monoclonal	large fragment (89 kDa) of human PARP1 protein produced by caspase cleavage.	-	Cell Signaling Technology	5625
primary-1197	GALNS	AB_11152499	GALNS Polyclonal Antibody	polyclonal		-	Thermo Fisher Scientific (Invitrogen)	PA5-22098
primary-1196	ARSA	AB_1078220	Anti-ARSA antibody produced in rabbit	polyclonal	LLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGSAHSDTTADPACHASSSLTAHEPPLLYDLSKDPGENYNLLGGVAGATPEVLQALKQLQLLKAQLDAAVTFGPSQ	-	Sigma-Aldrich (Atlas Antibodies)	HPA005554
primary-1192	CALB2	AB_2721226	Calretinin antibody	polyclonal		-	Swant	7697
primary-1191	BSN	AB_2661779	Bassoon antibody	unknown	Recombinant protein corresponding to residues corresponding to central region rat Bassoon. (UniProt Id: O88778)	-	Synaptic Systems	141 016
primary-1189	PCLO	AB_2619830	Piccolo antibody	unknown	Recombinant protein corresponding to a central region of rat piccolo (UniProt Id: Q9JKS6)	-	Synaptic Systems	142 113
primary-1188	HOME1	AB_2120990	Homer1 antibody	unknown	Recombinant protein corresponding to the N-terminal half of human Homer 1 (UniProt Id: Q86YM7)	-	Synaptic Systems	160 002
primary-1187	CACNA1D	AB_2039775	Anti-CaV1.3 (CACNA1D) Antibody - Voltage-dependent L-type calcium channel subunit α1D	polyclonal	Peptide (C)DNKVTIDDYQEEAEDKD, corresponding to amino acid residues 859-875 of rat CaV1.3	-		ACC-005
primary-1186	VCL	AB_10603627	Vinculin	monoclonal	total protein	-	Sigma-Aldrich	V9264
primary-1183	TNNI3	AB_11000742	Cardiac Troponin T Monoclonal Antibody (13-11)	monoclonal		-	Thermo Fisher Scientific	MA5-12960