Technical Support: menoci@medizin.uni-goettingen.de
Department of Medical Informatics
University Medical Center Göttingen
Imprint
View primary antibody
Basic data
| PID | primary-1263 |
| EPIC PID | https://hdl.handle.net/21.11124/primary-1263 |
| Research group | RG Schuh |
| Quality (mean) | no score (0.00) |
| Sharing level | Public |
Antibody data
| Antigen symbol | UBE2D3 |
| Antibody Registry ID(s) | AB_11014373 |
| Name | UbcH5c/UBE2D3 Antibody |
| Alternative name | |
| Lab ID | |
| Tag / Fluorophore | |
| Raised in | Rabbit |
| Reacts with | |
| Clone | |
| Isotype | IgG |
| Clonality | polyclonal |
| Demasking | unknown |
| Antigen | Synthetic peptides corresponding to UBE2D3(ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast)) |
| Crafted By | company |
| Company / Manufacturer | Novus |
| Catalog no. | NBP1-55276 |
| Lot no. | |
| Description | Synthetic peptides corresponding to UBE2D3(ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast)) The peptide sequence was selected from the N terminal of UBE2D3. Peptide sequence MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVF. The peptide sequence for this immunogen was taken from within the described region. |
| Localization | |
| Storage instruction | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Receipt date | 2023-11-03 00:00:00 |
| Preparation date | 2023-11-03 00:00:00 |
| Created by | , |
| Last modified | , |
External links
| Antibodypedia | - |
| HGNC | http://www.genenames.org/cgi-bin/gene_symbol_report?match=UBE2D3 |
| Wikipedia | http://en.wikipedia.org/wiki/UBE2D3 |
| Uniprot | http://www.uniprot.org/uniprot/?query=UBE2D3 |
| GeneCards | http://www.genecards.org/cgi-bin/carddisp.pl?gene=UBE2D3 |
| Antibody Registry | http://antibodyregistry.org/search?q=AB_11014373 |
Applications
No application comments yet.
Linked publications
Mammalian oocytes store proteins for the early embryo on cytoplasmic lattices
Jentoft IM, Bäuerlein FJ, Welp LM, Cooper BH, Petrovic A, So C, Penir SM, Politi AZ, Horokhovskyi Y, Takala I, Eckel H, Moltrecht R, Lénárt P, Cavazza T, Liepe J, Brose N, Urlaub H, Fernández-Busnadiego R, Schuh M
Cell 2023 : 10.1016/j.cell.2023.10.003
