Technical Support: menoci@medizin.uni-goettingen.de
Department of Medical Informatics
University Medical Center Göttingen
Imprint
AG | PID | Antigen Symbol | Antibody Registry | Name | Clonality | Antigen | Quality | Company | Catalog no. |
---|---|---|---|---|---|---|---|---|---|
![]() | primary-1220 | RPS6 | AB_2799618 | Phospho-S6 Ribosomal Protein (Ser235/236) (E2R1O) Mouse | monoclonal | - | Cell Signaling Technology | 62016 | |
![]() | primary-1219 | RPL24 | AB_2547631 | RPL24 Polyclonal Antibody | polyclonal | Recombinant protein fragment corresponding to a region within amino acids 1 and 157 of Human RPL24 | - | Thermo Fisher Scientific (Invitrogen) | PA5-30157 |
![]() | primary-1218 | COX17 | AB_2677911 | Polyclonal Anti-COX17 Antibody | polyclonal | - | Thermo Fisher Scientific | HPA042226 | |
![]() | primary-1217 | FIS1 | AB_1848608 | Anti-FIS1 antibody produced in rabbit | polyclonal | Mitochondrial fission 1 protein recombinant protein epitope signature tag (PrEST) | - | Sigma-Aldrich | HPA017430 |
![]() | primary-1216 | TOMM20 | AB_2303717 | TOMM20 Antibody (4F3) | monoclonal | TOMM20 (AAH66335, 1 a.a. ~ 145 a.a) full-length recombinant protein with GST tag. | - | Novus Biologicals | H00009804-M01 |
![]() | primary-1215 | CD107a | AB_657531 | CD107a (LAMP-1) Monoclonal Antibody (eBio1D4B (1D4B)) | monoclonal | - | Thermo Fisher Scientific (Invitrogen) | 14-1071-82 | |
![]() | primary-1214 | RAB11A | AB_2533987 | RAB11A Polyclonal Antibody | polyclonal | Synthetic peptide derived from the C-terminal hypervariable region of the human Rab11a sequence. | - | Thermo Fisher Scientific (Invitrogen) | 71-5300 |
![]() | primary-1213 | BAP31 | AB_2065142 | BAP31 Polyclonal antibody | polyclonal | BAP31 fusion protein Ag1668 | - | Proteintech | 11200-1-AP |
![]() | primary-1212 | KDEL | AB_10618036 | KDEL monoclonal antibody (10C3) | monoclonal | Synthetic peptide corresponding to aa 649-654 (S649EKDEL654) of rat Grp78. | - | Enzo Life Sciences | ADI-SPA-827 |
![]() | primary-1211 | PABPC1L | PABPC1L Antikörper (H-1) | monoclonal | raised against amino acids 485-529 mapping within an internal region of PABPC1L of mouse origin | - | Santa Cruz Biotechnology | sc-515476 | |
![]() | primary-1210 | eIF4ENIF1 | AB_2640973 | eIF4ENIF1 Polyclonal Antibody | polyclonal | - | Thermo Fisher Scientific (Invitrogen) | ||
![]() | primary-1209 | LSM14B | AB_2664653 | LSM14B Polyclonal Antibody | polyclonal | Recombinant Human LSM14B | - | Thermo Fisher Scientific (Invitrogen) | PA5-66371 |
![]() | primary-1208 | DDX6 | Anti-DDX6 antibody, Mouse monoclonal | monoclonal | - | Sigma-Aldrich | SAB4200837 | ||
![]() | primary-1207 | DDX6 | Recombinant Anti-DDX6 antibody [EPR12146] | monoclonal | Synthetic peptide within Human DDX6 aa 100-200 (Cysteine residue). The exact sequence is proprietary. | - | Abcam | ab174277 | |
![]() | primary-1206 | MSY2 | AB_776541 | Anti-MSY2/YBOX2/YBX2 antibody | polyclonal | Synthetic peptide corresponding to Mouse MSY2/YBOX2/YBX2 aa 300 to the C-terminus (C terminal). | - | Abcam | ab33164 |
![]() | primary-1205 | CYCS | AB_627381 | cytochrome c Antikörper (6H2) | monoclonal | - | Santa Cruz Biotechnology | sc-13561 | |
![]() | primary-1204 | ZAR1 | AB_2218783 | ZAR1(C-14) | polyclonal | - | Santa Cruz Biotechnology | sc-55994 | |
![]() | primary-1203 | FluoTag®-X2 anti-Mouse Ig kappa light chain | unknown | - | NanoTag Biotechnologies | N1202-Ab635P-S | |||
![]() | primary-1202 | FluoTag®-X2 anti-Rabbit IgG | unknown | - | NanoTag Biotechnologies | N2402-Ab635P-S | |||
![]() | primary-1201 | FluoTag®-X2 anti-PSD95 | unknown | - | NanoTag Biotechnologies | N3702-Ab580-L | |||
![]() | primary-1200 | MYC | AB_2266850 | c-Myc antibody (9E 10) | monoclonal | c-Myc (human; C-terminus a.a. 408-439) synthetic peptide. AEEQKLISEEDLLRKRREQLKHKLEQLRNSCA; a.a. 408-432 | - | DSHB | |
![]() | primary-1199 | VCP | AB_527461 | p97/VCP Antibody | polyclonal | region between residue 750 and the C-terminus (residue 806) of human Valosin-Containing Protein | - | ||
![]() | primary-1198 | PARP1 | AB_10699459 | poly(ADP-ribose) polymerase 1 | monoclonal | large fragment (89 kDa) of human PARP1 protein produced by caspase cleavage. | - | Cell Signaling Technology | 5625 |
![]() | primary-1197 | GALNS | AB_11152499 | GALNS Polyclonal Antibody | polyclonal | - | Thermo Fisher Scientific (Invitrogen) | PA5-22098 | |
![]() | primary-1196 | ARSA | AB_1078220 | Anti-ARSA antibody produced in rabbit | polyclonal | LLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGSAHSDTTADPACHASSSLTAHEPPLLYDLSKDPGENYNLLGGVAGATPEVLQALKQLQLLKAQLDAAVTFGPSQ | - | Sigma-Aldrich (Atlas Antibodies) | HPA005554 |