Primary antibodies

Export

PID	Antigen Symbol	Antibody Registry	Name	Clonality	Antigen	Quality	Company	Catalog no.
primary-1259	NALP5		Anti-NALP5 antibody	polyclonal	A Synthetic peptide (14 amino acid) from near the C terminus of Human NALP5 (NP_703148).	-	Abcam	ab105324
primary-0776	VAMP7	AB_1271093	Anti-SYBL1/VAMP-7 antibody	polyclonal	A synthetic peptide as a part of human (and other species) SYBL1 conjugated to an immunogenic carrier protein	-	Abcam	ab68776
primary-1261	NLRP14	AB_10905283	NLRP14 polyclonal antibody	polyclonal	A synthetic peptide corresponding to 16 amino acids near N-terminus of human NLRP14.	-	Abnova	PAB19311
primary-1081	PRKD2		PRKD2 (phospho S876) polyclonal antibody	polyclonal	A synthetic peptide corresponding to amino acids 810-890 of human PRKD2 (phospho S876).	-	Abnova	PAB31649
primary-0698	CAMK2B	AB_10675311	CaMKII monoclonal antibody	monoclonal	A synthetic peptide corresponding to CaMKII	-	Abnova	MAB6627
primary-0133	EPN1	AB_2231149	Epsin 1 Antibody	monoclonal	A synthetic peptide corresponding to residues in human Epsin-1 was used as an immunogen	-	Novus Biologicals	NBP1-40602
primary-0127	CALM1	AB_837786	Calmodulin Antibody	monoclonal	A synthetic peptide corresponding to residues in the C-terminus of human Calmodulin was used as immunogen.	-	Novus Biologicals	NB110-55649
primary-0728	KCNJ2	AB_11023524	Kir2.1 Antibody	monoclonal	A synthetic peptide corresponding to residues in the extracellular domain of human IRK1 / KCNJ2 was used as an immunogen	-	Novus Biologicals	NBP1-95482
primary-1099	APC	AB_2242783	Anti-APC (Ab-1) Mouse mAb (FE9)	monoclonal	a synthetic peptide corresponding to the N-terminal 35 amino acids of APC	-	Merck Millipore	OP44
primary-0135	UNC13B	AB_10782694	Unc-13 Homolog B (C. Elegans) (UNC13B) (AA 1000-1050) antibody	polyclonal	A synthetic peptide from aa region 1000-1050 of human MUNC13-1 (UNC13A)	-	Antibodies-Online	ABIN571921
primary-0143	SNAP29	AB_1142975	Anti-SNAP29 antibody	polyclonal	A synthetic peptide from part of rat SNAP29, conjugated to an immunogenic carrier protein	-	Abcam	ab68824
primary-1168	SOX2	AB_792071	SOX2 Antibody - BSA Free	polyclonal	A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431]	-	Novus Biologicals	NB110-37235SS
primary-1354	MIC60		anti-MIC60	unknown	AAKPKDNPLPRDVVELEKA synthetic peptide	-
primary-0163	ACAD9	AB_2241997	ACAD9 antibody	polyclonal	ACAD9 fusion protein Ag8414	-	Proteintech	15770-1-AP
primary-0083	ACE2	AB_10732845	ACE2 antibody	polyclonal	ACE2 fusion protein Ag15455	-	Proteintech	21115-1-AP
primary-0258	TUBA4A	AB_477585	Monoclonal Anti-Tubulin	monoclonal	acetylated α-tubulin from the outer arm of sea urchin sperm axonemes.	-	Sigma-Aldrich	T6793
primary-1140	TNFRSF4	AB_2742502	BV421 Mouse Anti-Rat CD134	monoclonal	Activated rat lymph node cells	-	BD Biosciences	744815
primary-1138	PECAM1	AB_322925	CD31 antibody	monoclonal	Activated, Lewis rat derived microglial cells.	-	Bio Rad	MCA1334G
primary-0782	AGE	AB_447638	Anti-AGE antibody	polyclonal	Advanced Glycation End Products (BSA-AGE and HSA-AGE)	-	Abcam	ab23722
primary-0104	AQP1	AB_626693	AQP1 (1/22) antibody	monoclonal	against amino acid sequence 249-269 of intracellular AQP1 from the species rat	-	Santa Cruz Biotechnology	sc-32737
primary-0665	CALB2	AB_10000342	Goat antibody to Calretinin	unknown	against human recombinant calretinin.	-	Swant	CG1
primary-0631	SQSTM1	AB_2564787	Purified anti-p62 (SQSTM1) Antibody	monoclonal	against a peptide sequence corresponding to amino acids 201-212 of human SQSTM 1 protein conjugated to KLH.	-	BioLegend	814801
primary-0591	P2RY12	AB_2810254	P2Y12/P2RY12 Antibody	polyclonal	Against a recombinant protein corresponding to amino acids: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM	-	Novus Biologicals	NBP2-33870
primary-0689	AKT1	AB_915783	Akt (pan) (C67E7) Rabbit mAb	monoclonal	Akt (pan) (C67E7) Rabbit mAb detects endogenous levels of total Akt protein	-	Cell Signaling Technology	4691
primary-0450	Alexa Fluor 488	AB_221544	Alexa Fluor 488 Polyclonal Antibody	polyclonal	Alexa Fluor 488 coupled to carrier protein	-	Thermo Fisher Scientific (Invitrogen)	A-11094