Technical Support: menoci@medizin.uni-goettingen.de
Department of Medical Informatics
University Medical Center Göttingen
Imprint
PID | primary-0591 |
EPIC PID | https://hdl.handle.net/21.11124/primary-0591 |
Research group | RG Gärtner |
Quality (mean) | no score (0.00) |
Sharing level | Public |
Antigen symbol | P2RY12 |
Antibody Registry ID(s) | AB_2810254 |
Name | P2Y12/P2RY12 Antibody |
Alternative name | SP1999 |
Lab ID | |
Tag / Fluorophore | |
Raised in | Rabbit |
Reacts with | Human, Canine, Feline |
Clone | |
Isotype | IgG |
Clonality | polyclonal |
Demasking | unknown |
Antigen | Against a recombinant protein corresponding to amino acids: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM |
Crafted By | company |
Company / Manufacturer | Novus Biologicals |
Catalog no. | NBP2-33870 |
Lot no. | |
Description | Western Blot 0.04 - 0.4 ug/ml Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL Immunohistochemistry 1:1000 - 1:2500 Immunohistochemistry-Frozen Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
Localization | |
Storage instruction | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Receipt date | 2021-07-12 00:00:00 |
Preparation date | 2021-07-12 00:00:00 |
Created by | Klauenberg, Vanessa |
Last modified | Klauenberg, Vanessa |
No application comments yet.
Concurrent axon and myelin destruction differentiates X-linked adrenoleukodystrophy from multiple sclerosis
Bergner CG, Genc N, Hametner S, Franz J, Meer F, Mitkovski M, Weber MS, Stoltenburg‐Didinger G, Kühl J, Köhler W, Brück W, Gärtner J, Stadelmann C
Glia 2021 : 10.1002/glia.24042