Technical Support: support.menoci@medizin.uni-goettingen.de
Department of Medical Informatics
University Medical Center Göttingen
Imprint
View primary antibody
Basic data
| PID | primary-0591 |
| EPIC PID | https://hdl.handle.net/21.11124/primary-0591 |
| Research group | RG Gärtner |
| Quality (mean) | no score (0.00) |
| Sharing level | Public |
Antibody data
| Antigen symbol | P2RY12 |
| Antibody Registry ID(s) | AB_2810254 |
| Name | P2Y12/P2RY12 Antibody |
| Alternative name | SP1999 |
| Lab ID | |
| Tag / Fluorophore | |
| Raised in | Rabbit |
| Reacts with | human, canine, feline |
| Clone | |
| Isotype | IgG |
| Clonality | polyclonal |
| Demasking | unknown |
| Antigen | Against a recombinant protein corresponding to amino acids: KSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM |
| Crafted By | company |
| Company / Manufacturer | Novus Biologicals |
| Catalog no. | NBP2-33870 |
| Lot no. | |
| Description | Western Blot 0.04 - 0.4 ug/ml Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL Immunohistochemistry 1:1000 - 1:2500 Immunohistochemistry-Frozen Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Localization | |
| Storage instruction | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Receipt date | 2021-07-12 00:00:00 |
| Preparation date | 2021-07-12 00:00:00 |
| Created by | Klauenberg, Vanessa |
| Last modified | Klauenberg, Vanessa |
External links
Applications
No application comments yet.
Linked publications
Concurrent axon and myelin destruction differentiates X-linked adrenoleukodystrophy from multiple sclerosis
Bergner CG, Genc N, Hametner S, Franz J, Meer F, Mitkovski M, Weber MS, Stoltenburg‐Didinger G, Kühl J, Köhler W, Brück W, Gärtner J, Stadelmann C
Glia 2021 : 10.1002/glia.24042
