Primary antibodies

Search:
Export
AG PID Antigen Symbol Antibody Registry Name Clonality Antigen Quality Company Catalog no.
primary-0888 OSGEPL1 AB_2813600 OSGEPL1 Polyclonal Antibody polyclonal Recombinant Human Probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial protein (1-270AA) Thermo Fisher Scientific (Invitrogen) PA5-98987
primary-0885 METTL8 AB_10670116 Anti-METTL8 antibody polyclonal methyltransferase like 8 recombinant protein epitope signature tag (PrEST) Sigma-Aldrich (Atlas Antibodies) HPA035421
primary-0884 RBFOX3 AB_10711040 Anti-NeuN antibody [1B7] - Neuronal Marker monoclonal Recombinant fragment corresponding to Human NeuN aa 1-100 (N terminal). Expressed in and purified from E. coli. Abcam ab104224
primary-0883 SQSTM1 AB_2885112 Recombinant Anti-SQSTM1 / p62 antibody [EPR18351] monoclonal Recombinant full length protein. This information is proprietary to Abcam and/or its suppliers. Abcam ab207305
primary-0881 MYL7 AB_887737 MLC-2A antibody monoclonal Recombinant protein corresponding to AA 1 to 175 from human MLC-2A Synaptic Systems 311 011
primary-0880 NPPA AB_2683660 Anti-NPPA Antibody polyclonal Antigen Sequence GQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWT Atlas Antibodies HPA058269
primary-0879 STOML2 AB_2286822 STOML2 Polyclonal antibody polyclonal STOML2 fusion protein Ag0363 Proteintech 10348-1-AP
primary-0878 PHB AB_2164476 Prohibitin Polyclonal antibody polyclonal Prohibitin fusion protein Ag1240 Proteintech 10787-1-AP
primary-0877 AP3S1 AP3S1 Rabbit Polyclonal Antibody polyclonal raised against a 19 amino acid synthetic peptide near the center of human AP3S1. Origene TA319631
primary-0876 HPRT1 AB_297217 Anti-HPRT antibody polyclonal Synthetic peptide Abcam ab10479
primary-0875 BECN1 AB_1903911 Beclin-1 (D40C5) Rabbit mAb monoclonal Beclin-1 (D40C5) Rabbit mAb detects endogenous levels of total Beclin-1 protein. Cell Signaling Technology 3495
primary-0874 TUB AB_2884950 hFAB™ Rhodamine Anti-Tubulin Primary Antibody unknown Recombinant human β-tubulin expressed in E.coli Bio Rad 12004166
primary-0873 MAP1LC3B AB_2137707 LC3B (D11) XP® Rabbit mAb monoclonal LC3B (D11) XP® Rabbit mAb detects endogenous levels of total LC3B protein. Cell Signaling Technology 3868
primary-0872 LAMP1 AB_449893 Anti-LAMP1 antibody monoclonal Plasma membrane fraction of mouse embryo NIH3T3 cell line. Abcam ab25245
primary-0871 AP3M1 AB_2715538 Recombinant Anti-AP3M1 antibody monoclonal Synthetic peptide. Abcam ab201227
primary-0870 CLTC AB_303256 Anti-Clathrin heavy chain antibody [X22] monoclonal Full length native protein (purified) corresponding to Human Clathrin heavy chain. Abcam ab2731
primary-0868 His-Tag AB_2744546 His-Tag (D3I1O) XP® Rabbit mAb monoclonal Antibody recognizes 6xHis-tag fused to either the amino or carboxy terminus of targeted proteins in transfected cells. Cell Signaling Technology 12698
primary-0866 MBP AB_2799920 Myelin Basic Protein (D8X4Q) XP® Rabbit mAb monoclonal Myelin Basic Protein (D8X4Q) XP® Rabbit mAb recognizes endogenous levels of total myelin basic protein. Cell Signaling Technology 78896
primary-0865 GFAP AB_887720 GFAP antibody polyclonal Recombinant protein corresponding to AA 1 to 432 from human GFAP Synaptic Systems 173 002
primary-0864 RBFOX3 AB_2619988 NeuN antibody polyclonal Recombinant protein corresponding to AA 1 to 97 from mouse NeuN Synaptic Systems 266 004
primary-0863 RAB11B AB_10861613 Anti-RAB11B antibody polyclonal Synthetic peptide corresponding to Human RAB11B aa 1-100. Abcam ab3612
primary-0862 RAB11A AB_2173452 Rab11a Antibody polyclonal Rab11a Antibody detects endogenous levels of total Rab11a protein. Cell Signaling Technology 2413
primary-0861 LAMP1 AB_775978 Anti-LAMP1 antibody - Lysosome Marker polyclonal Synthetic peptide corresponding to Human LAMP1 aa 400 to the C-terminus conjugated to keyhole limpet haemocyanin. Abcam ab24170
primary-0860 ITGB1 AB_395637 Purified Hamster Anti-Rat CD29 monoclonal Rat glomerular epithelial cells BD Biosciences 555003
primary-0859 ITGB1 AB_10894590 FITC Hamster Anti-Rat CD29 monoclonal Rat glomerular epithelial cells BD Biosciences 561796