Technical Support: support.menoci@medizin.uni-goettingen.de
Department of Medical Informatics
University Medical Center Göttingen
Imprint
View primary antibody
Basic data
| PID | primary-1295 |
| EPIC PID | https://hdl.handle.net/21.11124/primary-1295 |
| Research group | RG Zafeiriou |
| Quality (mean) | no score (0.00) |
| Sharing level | Public |
Antibody data
| Antigen symbol | SOX17 |
| Antibody Registry ID(s) | AB_2685981 |
| Name | Polyclonal Anti-SOX17 Antibody |
| Alternative name | SRY (sex determining region Y)-box 17 |
| Lab ID | |
| Tag / Fluorophore | |
| Raised in | Rabbit |
| Reacts with | human |
| Clone | |
| Isotype | IgG |
| Clonality | polyclonal |
| Demasking | unknown |
| Antigen | |
| Crafted By | company |
| Company / Manufacturer | Atlas Antibodies |
| Catalog no. | HPA068399 |
| Lot no. | |
| Description | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence MSSPDAGYASDDQSQTQSALPAVMAGLGPCPWAESLSPIGDMKVKGE |
| Localization | |
| Storage instruction | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Receipt date | 2023-12-01 00:00:00 |
| Preparation date | 2023-12-14 00:00:00 |
| Created by | , |
| Last modified | , |
External links
| Antibodypedia | - |
| HGNC | http://www.genenames.org/cgi-bin/gene_symbol_report?match=SOX17 |
| Wikipedia | http://en.wikipedia.org/wiki/SOX17 |
| Uniprot | http://www.uniprot.org/uniprot/?query=SOX17 |
| GeneCards | http://www.genecards.org/cgi-bin/carddisp.pl?gene=SOX17 |
| Antibody Registry | http://antibodyregistry.org/search?q=AB_2685981 |
Applications
No application comments yet.
Linked publications
Generation of Pelizaeus-Merzbacher disease (PMD) mutant (PLP1-C33Y) in induced pluripotent stem cell (iPSC) by CRISPR/Cas9 genome editing
Schreiber M, Zafeiriou M
Stem Cell Res 2023 : 10.1016/j.scr.2023.103276
Generation of a fluorescent oligodendrocyte reporter line in human induced pluripotent stem cells
Schreiber M, Zafeiriou M
Stem Cell Res 2023 : 10.1016/j.scr.2023.103295
