Technical Support: support.menoci@medizin.uni-goettingen.de
Department of Medical Informatics
University Medical Center Göttingen
Imprint
| PID | primary-1252 |
| EPIC PID | https://hdl.handle.net/21.11124/primary-1252 |
| Research group | RG Schuh |
| Quality (mean) | no score (0.00) |
| Sharing level | Public |
| Antigen symbol | LONRF3 |
| Antibody Registry ID(s) | AB_1843962 |
| Name | Monoclonal Anti-RNF127 antibody produced in mouse |
| Alternative name | |
| Lab ID | |
| Tag / Fluorophore | |
| Raised in | Mouse |
| Reacts with | |
| Clone | 1D5 |
| Isotype | IgG2aκ |
| Clonality | monoclonal |
| Demasking | unknown |
| Antigen | RNF127 (NP_079054, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Crafted By | company |
| Company / Manufacturer | Sigma-Aldrich |
| Catalog no. | WH0079836M1 |
| Lot no. | |
| Description | Immunogen: RNF127 (NP_079054, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: MESVRIEQMLSLPAEVSSDNLESAERGASAAQVDMGPHPKVAAEGPAPLPTREPEQEQSPGTSTPESKVLLTQADALASRGRIREALEVY |
| Localization | |
| Storage instruction | −20°C |
| Receipt date | 2023-11-03 00:00:00 |
| Preparation date | 2023-11-03 00:00:00 |
| Created by | , |
| Last modified | , |
| Antibodypedia | - |
| HGNC | http://www.genenames.org/cgi-bin/gene_symbol_report?match=LONRF3 |
| Wikipedia | http://en.wikipedia.org/wiki/LONRF3 |
| Uniprot | http://www.uniprot.org/uniprot/?query=LONRF3 |
| GeneCards | http://www.genecards.org/cgi-bin/carddisp.pl?gene=LONRF3 |
| Antibody Registry | http://antibodyregistry.org/search?q=AB_1843962 |
No application comments yet.
Mammalian oocytes store proteins for the early embryo on cytoplasmic lattices
Jentoft IM, Bäuerlein FJ, Welp LM, Cooper BH, Petrovic A, So C, Penir SM, Politi AZ, Horokhovskyi Y, Takala I, Eckel H, Moltrecht R, Lénárt P, Cavazza T, Liepe J, Brose N, Urlaub H, Fernández-Busnadiego R, Schuh M
Cell 2023 : 10.1016/j.cell.2023.10.003