Technical Support: support.menoci@medizin.uni-goettingen.de
Department of Medical Informatics
University Medical Center Göttingen
Imprint
| PID | primary-0880 |
| EPIC PID | https://hdl.handle.net/21.11124/primary-0880 |
| Research group | RG Cyganek |
| Quality (mean) | no score (0.00) |
| Sharing level | Public |
| Antigen symbol | NPPA |
| Antibody Registry ID(s) | AB_2683660 |
| Name | Anti-NPPA Antibody |
| Alternative name | |
| Lab ID | |
| Tag / Fluorophore | |
| Raised in | Rabbit |
| Reacts with | human |
| Clone | |
| Isotype | IgG |
| Clonality | polyclonal |
| Demasking | unknown |
| Antigen | Antigen Sequence GQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWT |
| Crafted By | company |
| Company / Manufacturer | Atlas Antibodies |
| Catalog no. | HPA058269 |
| Lot no. | |
| Description | Immunohistochemistry (IHC) Recommended conditions: Dilution: 1:5000 - 1:10000 Retrieval method: HIER pH6 |
| Localization | |
| Storage instruction | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Receipt date | 2022-01-08 00:00:00 |
| Preparation date | 2022-01-08 00:00:00 |
| Created by | Klauenberg, Vanessa |
| Last modified | Klauenberg, Vanessa |
No application comments yet.
Proteomic mapping of atrial and ventricular heart tissue in patients with aortic valve stenosis
Barbarics B, Eildermann K, Kaderali L, Cyganek L, Plessmann U, Bodemeyer J, Paul T, Ströbel P, Urlaub H, Tirilomis T, Lenz C, Bohnenberger H
Sci Rep 2021 : 10.1038/s41598-021-03907-3